PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT31776
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family WRKY
Protein Properties Length: 391aa    MW: 42215.8 Da    PI: 8.6142
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT31776genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.11.6e-32249307159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ldDgy+WrKYGqK vk+s fprsYYrCt a+C vkk vers++dp++v++tYeg+H h+
  EMT31776 249 LDDGYRWRKYGQKAVKNSSFPRSYYRCTAAQCGVKKLVERSQQDPSTVVTTYEGRHAHP 307
               59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.3E-32236309IPR003657WRKY domain
SuperFamilySSF1182906.02E-28242309IPR003657WRKY domain
PROSITE profilePS5081130.343244309IPR003657WRKY domain
SMARTSM007745.2E-37249308IPR003657WRKY domain
PfamPF031061.6E-25250307IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MSGSAAASGG DLGGGQIYGD HVFFQSQSAC GGGDGGGVIP STYSSITDYL HGLLDPAELA  60
KHLDVPPCYP TMRDAIGAVA TPVTPNSSTS GEAAGAESHG GKRGRPSPEE GDEDRSAGQR  120
RRGGSQAPGR TSVLPDDERR DRRGSDSGHA QLVEVIEKLG YHGYHEIPRR FRTIYESEQI  180
SSKIVSNSKF QNFFAWEVDF SWGTGKCGYQ AVSELSGRSE KKKTKEGKRE KKPRGSRVAF  240
ATKSEVDHLD DGYRWRKYGQ KAVKNSSFPR SYYRCTAAQC GVKKLVERSQ QDPSTVVTTY  300
EGRHAHPSPV AAHCGSRMLM GTGVHTVYSL DVLQHQHRGF FPAGTDVYGR MCAPPSTAAS  360
VVAHRSSEYG GMQAQAGLLP DAVMSYEHVH P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-262423091077Probable WRKY transcription factor 4
2lex_A8e-262423091077Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM8D5Y80.0M8D5Y8_AEGTA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62337173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.19e-37WRKY DNA-binding protein 23